PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009117543.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BES1
Protein Properties Length: 319aa    MW: 34918.8 Da    PI: 9.9081
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009117543.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822193.67.1e-60151542149
          DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqs 96 
                     +++rkp+w+ErEnn+rRER+RRa+aakiy GLRaqGn++lp ++DnneVlkALc eAGwvve+DGttyrkg kpl   ++agss++a+  ss++ 
  XP_009117543.1  15 ATRRKPSWRERENNRRRERKRRAVAAKIYNGLRAQGNFNLPRHCDNNEVLKALCSEAGWVVEEDGTTYRKGHKPL-PDDMAGSSSRATAYSSYN- 107
                     689************************************************************************.999*************99. PP

          DUF822  97 slkssalaspvesysaspksssfpspssldsislasaasllpvlsvlslvsss 149
                         s ++sp+ sy+asp+sssfpsp   d+ +++   +++p+l++ +  +ss
  XP_009117543.1 108 ---QSPFESPILSYQASPSSSSFPSPRGGDTHNIS---TIFPFLRNGGINPSS 154
                     ...889*************************9995...899999988876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.6E-5716140IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MTSEGAMLTS AAAMATRRKP SWRERENNRR RERKRRAVAA KIYNGLRAQG NFNLPRHCDN  60
NEVLKALCSE AGWVVEEDGT TYRKGHKPLP DDMAGSSSRA TAYSSYNQSP FESPILSYQA  120
SPSSSSFPSP RGGDTHNIST IFPFLRNGGI NPSSLPPLRI SNSAPVTPPV SSPTSRNPKP  180
LPTWESLTKQ AMANAARQSV SSFNYPFYAV SAPTSPTHHR QFNAPATIPE CDESDSSTTD  240
SGHWISFQKF SQQQFRGGFA VPPSPTFNLV KPPLPQQLSS NIAAAQEIGS QVKPWEGERI  300
HDVAMEDLEL TLGNSKGRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11635RRKPSWRERENNRRRERKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009117543.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 2-like
RefseqXP_009117544.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 2-like
RefseqXP_009117545.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 2-like
RefseqXP_009117546.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 2-like
RefseqXP_013664647.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 2-like
SwissprotQ9LN631e-167BZR2_ARATH; Protein BRASSINAZOLE-RESISTANT 2
TrEMBLA0A078G5C80.0A0A078G5C8_BRANA; BnaA09g44210D protein
TrEMBLM4EQK60.0M4EQK6_BRARP; Uncharacterized protein
STRINGBra031077.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24722772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.61e-140BES1 family protein